DPCstruct | MC1533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 70 ± 10 aa |
| Standard deviation of domain lengths | 10.35 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 44.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y7ULZ9 | 7-71 | SAIIIFLLLGINSALGYSVKYQKGYMKKNGTYVQGHYKTVSNSKKSDNFSTKGNYNPYTGKKGYT |
| A0A662W0Y5 | 15-87 | FSTLVLILAIFGLVTSSFADVSVRGHLRKNPKGGWSWVPPHWRSDPDGNPFNNWSFPGNVNPHTGKVAPGNPD |
| A0A507ZGL5 | 124-172 | None |
| A0A250G4Y2 | 2-54 | None |
| A0A1V4ANA2 | 7-70 | None |
| A0A6N8BNU2 | 7-70 | None |
| A0A0G0PWA4 | 16-106 | None |
| A0A2W4I1A1 | 243-311 | None |
| A0A7Y9FNM4 | 7-71 | None |
| A0A560BNF7 | 12-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.