DPCstruct | MC15327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 130 ± 23 aa |
| Standard deviation of domain lengths | 22.80 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 37.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0375 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q2XD46 | 125-228 | GLWWTYLISLFAKTGIEIAFLYILHRIYNSFYLPRLVKCEVSPCPNIVDCYIGHPTEKKVFTYFMVGASALCIVLNICEIFYLIYKR… |
| G1U794 | 1-182 | MLGLGEDAEEEPGAPEGPAEDAEEERAEEAATKGAGGGGEAAGTPGPATQHDGRRRIQREGLMRVYVVQLVVRAAFEVAFLVGQYLL… |
| H2Y5A5 | 92-185 | None |
| A0A6J0I1S2 | 204-335 | None |
| A0A1L8HJ47 | 214-309 | None |
| M7BS41 | 73-231 | None |
| A0A5C6NIL1 | 408-529 | None |
| A0A668A3Q7 | 25-167 | None |
| Q6DEG1 | 112-212 | None |
| A0A654ICJ2 | 18-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.