DPCstruct | MC15325
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 240 ± 17 aa |
| Standard deviation of domain lengths | 16.89 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00681 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0CCT0 | 1-234 | MNRILADPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLYMLEIVKKGETYSHIDETTRQALRSRTMKMYVGKFAGQTVSVWDLL… |
| A0A3B4CZT5 | 292-523 | QLLANPDDDTKWYSDQNTKGNLTYQQLRERCIKNSNTGLLLLPVPENNERSIYTDEQVKTVFKEKSLVNVAGKFEGLRVSLWDVLMS… |
| H3CB78 | 317-548 | None |
| L9KKX9 | 77-315 | None |
| A0A6A5ELQ0 | 291-555 | None |
| A0A3Q7UG82 | 2-228 | None |
| A0A3Q3D670 | 226-443 | None |
| A0A6A4RVF2 | 1-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.