DPCstruct | MC15321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 56 ± 9 aa |
| Standard deviation of domain lengths | 8.67 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 82.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381G4G9 | 1-50 | MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVITAEI |
| G5QW22 | 1-71 | MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPTAVPVQQSVITAEIERWPETALTRELARHPAPPGL |
| A0A7Z7KRT2 | 1-50 | None |
| A0A378F945 | 1-50 | None |
| A0A447U889 | 148-219 | None |
| A0A2X3IYZ2 | 1-61 | None |
| A0A2X4USC3 | 1-50 | None |
| A4N4A9 | 8-61 | None |
| C0AX34 | 1-48 | None |
| A0A7H4MEV8 | 1-50 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.