DPCstruct | MC1532
Metacluster Properties and Pfam Annotations
| Number of structural domains | 183 |
|---|---|
| Mean domain length (aa) | 279 ± 50 aa |
| Standard deviation of domain lengths | 50.49 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.63 |
| Pfam Score | 89.87 |
| Assigned Pfam label(s) | PF00773- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A660MYN8 | 19-305 | AREKYSPYALQQARNIVKYGTIDKAKHREFVEGISIDAKESKDLDDAIWAEKYSNGYKVWIHISDPTENIKKYSPLDLEALKRTTSI… |
| A0A1D6JMH5 | 307-479 | TETEVVLIENDINTRPFSTQVLACLPPLPWTLSPEDLANPNRQDLRQVRVFSVDPPGCRDIDDALHCTLLPNGNFEVGVHIADVTNF… |
| A0A0K2R4Z5 | 3-243 | None |
| S4R6J8 | 142-394 | None |
| A0A2V2XG70 | 288-600 | None |
| A0A379B129 | 68-307 | None |
| A0A453PMW6 | 248-535 | None |
| A0A1F7YWE7 | 9-262 | None |
| S7WLJ5 | 2-308 | None |
| A0A4S4EV27 | 424-750 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.