DPCstruct | MC15318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 123 ± 18 aa |
| Standard deviation of domain lengths | 18.25 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0CE18 | 2-109 | NVATFDPILIGSVILMQIGARHLDLELTPFQRQLLKNKVIQGIILFGIIYIPVRDFKKTLLILILIYLIVYVLFNENHNYNLFSKKF… |
| A0A6C0EAT5 | 11-126 | GGFINMVDASFNILNNSKYFAGLMMLLMNLGSRYISLELSQFQEEILSNVIVRRAIVFTIIFIATRDIKISLIFTALFIILVSGVFN… |
| A0A6C0CVG2 | 59-206 | None |
| A0A6C0LM44 | 122-255 | None |
| A0A381ZDF8 | 2-98 | None |
| A0A6C0DCN7 | 18-115 | None |
| A0A2D5PPS6 | 4-138 | None |
| A0A6C0IDE5 | 5-133 | None |
| A0A6C0I173 | 18-159 | None |
| A0A6C0HP61 | 15-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.