DPCstruct | MC15316
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 237 ± 33 aa |
| Standard deviation of domain lengths | 32.88 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 23.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0D897 | 1-201 | MSLYIHPENQTLLWNTLQKNPKFQNLTINKQEWFSSIIKAFYEKIQYLPPLTTQELLQINRQTISYMMEEINALLVDRPKFAESKKV… |
| A0A6C0E9J9 | 1-236 | MSIYTHPDNQELLWNIINQNHFINSYFLQFPNQKKEFWFKTVIEAIYNKNPNPNITKDDLYKMNQDTIFTMIQIIREKMVEATKTTN… |
| A0A6C0JXB6 | 6-213 | None |
| A0A6C0FFL0 | 1-232 | None |
| A0A6C0IBZ7 | 1-215 | None |
| A0A6C0HTD4 | 1-298 | None |
| A0A2E1CFX5 | 1-221 | None |
| A0A6C0DQQ4 | 1-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.