DPCstruct | MC15315
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 64 ± 7 aa |
| Standard deviation of domain lengths | 6.57 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q8V7A0 | 2-68 | HVFVIPTQRFLACHVCEGLVFAQREIKMTTTGMTFFDLDWLNKSADGAICVRCGYVHTFMGNAHQWV |
| A0A6C0E7R9 | 29-96 | KDVKKWIMNGKEIRCPHCLQNLFYMRKALLNTPGMTFFDLDAFNKNAYILKCQTCSMILWFNKKPTVN |
| A0A142YH82 | 17-88 | None |
| A0A1E3C4C0 | 2-58 | None |
| A0A842JDN2 | 7-70 | None |
| A0A7X9HRX8 | 2-57 | None |
| U1XW47 | 18-75 | None |
| A0A3N5LTD1 | 22-71 | None |
| A0A2P8H3R4 | 22-96 | None |
| A0A5J4KUN7 | 128-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.