DPCstruct | MC15313
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 84 ± 5 aa |
| Standard deviation of domain lengths | 5.19 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 49.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A519CGV5 | 28-111 | TDKRNRKKIAKPLPAGITQDMMPKYVYYCKECYNKEKQLYREFFRIEKHPKLNKKCISSSKSSKLTILQKLTEIKKKLYNLDND |
| A0A6C0BXY2 | 557-637 | KMKRQQTASALPEGLTQDMMPKYVNYNRECYDVKKQSYRDFFRIEKHPKSKKIISSSKSAKLTVIQKLDDIKTKLYNLEND |
| A0A6C0DHG6 | 143-223 | None |
| A0A6C0D9H7 | 230-325 | None |
| A0A6C0K211 | 262-342 | None |
| A0A6C0HUY0 | 382-467 | None |
| A0A6C0LB06 | 152-230 | None |
| A0A6C0EQS4 | 119-197 | None |
| A0A6C0EDP8 | 270-359 | None |
| A0A6C0ITD0 | 245-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.