DPCstruct | MC15312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 144 ± 21 aa |
| Standard deviation of domain lengths | 21.37 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 26.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0H5M6 | 1-109 | MTIIQNAIRANVYHRSNKQYIVAPFDCDALKIIMRAIFLQHSDNNFNNIKQQISNLNQMVIDFCVPKVFSEAQSYLRYLYDVDNLVQ… |
| A0A6C0DZX4 | 55-211 | ITIDDKNISKNNTKQVFKNQYSDTLLTQMFFSQTNVENIQQLLRLFIYKKTNIIIDKQSYNELLTIMRSIFLEYSSHPPIIESNMSD… |
| A0A6C0H114 | 64-224 | None |
| A0A6C0DD13 | 34-172 | None |
| A0A6C0LES4 | 86-277 | None |
| A0A6C0L1E2 | 7-130 | None |
| A0A6C0FBI6 | 129-270 | None |
| A0A6C0D0P2 | 100-269 | None |
| A0A1Y1I8N5 | 252-385 | None |
| A0A6C0CDU8 | 113-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.