DPCstruct | MC1531
Metacluster Properties and Pfam Annotations
| Number of structural domains | 510 |
|---|---|
| Mean domain length (aa) | 346 ± 86 aa |
| Standard deviation of domain lengths | 86.19 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 88.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.86 |
| Pfam Score | 97.77 |
| Assigned Pfam label(s) | CL0172- CL0063- CL0099- CL0192- PF07059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A533IGF6 | 33-334 | NQEVIFTVTEGTKEDAEQAILAARRSFENGEWSQETSEVRGKKVRAIADKITENRDELAKLETLDTGKTLEESYADMDDIANVFNYF… |
| A0A1Z5TJ87 | 9-365 | EQAARSAKISSRTLATLPVSARNAALDAVHDALAAARESILEANAKDMELAKQSSASGELSPGIMKRLDLSRKGKFDDMLQGIKDVR… |
| A0A7R9KRY6 | 307-674 | None |
| H0ELL3 | 1-228 | None |
| H0EVN6 | 212-564 | None |
| H0EXP9 | 156-512 | None |
| R5NDY5 | 3-237 | None |
| A0A0B0P8Q8 | 34-246 | None |
| A0A418WGJ6 | 234-624 | None |
| R5LQZ2 | 5-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.