DPCstruct | MC15308
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 126 ± 9 aa |
| Standard deviation of domain lengths | 9.38 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19662 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6FK61 | 1-127 | MNNPKVPVSWGELFDKITILQIKSEKLCSPPAIKNVNTELHMLSTIIDEKVPNLSEAKEFEKELKLINQQLWDIEDQIREKERKKIF… |
| A0A6C0DNF1 | 282-411 | TNNKMIQIPVCNGELVDKLTILEIKKNKMTGDKLENVTKEYDLLYPYLVQIGLSREHELFKKLYDINLEFWEYHDWQRERWRLLENA… |
| A0A7V1HEA5 | 262-386 | None |
| A0A1Q7BD65 | 8-135 | None |
| A0A7V4PD70 | 416-555 | None |
| A0A6C0K569 | 1-122 | None |
| L1IJI4 | 314-449 | None |
| A0A2E5PL85 | 1-123 | None |
| A0A7X3P7H4 | 339-469 | None |
| A0A523RL65 | 36-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.