DPCstruct | MC15307
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 213 ± 42 aa |
| Standard deviation of domain lengths | 41.89 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.04 |
| Pfam Score | 61.31 |
| Assigned Pfam label(s) | CL0163- PF04152- PF12320 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H7C818 | 23-229 | LTGHLHVAGGIESEGAERRILVGGQHAVPHDVFPAEASYVALGHLHKAQAIGRDTIRYSGSLIPLSATEMPYAHGVTLVSLDGTTVL… |
| R5J3H3 | 43-228 | IQILMAHGGDAAHLPINFNSLELSPFSYIALGHIHKPQVISEDKIAYCGSPEPLDLTETGVHGYFTGEIHPETHKLTHLEFVPAATL… |
| A0A7M7NCG3 | 199-443 | None |
| B0EB30 | 185-393 | None |
| A0A2S4MDB3 | 93-313 | None |
| A0A7C5MJS9 | 47-294 | None |
| A0A6L5G3L7 | 130-358 | None |
| A0A3A0CPJ2 | 156-336 | None |
| A0A2P4ZPD5 | 161-364 | None |
| A0A2X2CKP8 | 34-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.