DPCstruct | MC15306
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 470 ± 87 aa |
| Standard deviation of domain lengths | 87.34 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2DN95 | 31-431 | LIDHPAHPKEIARTCMPCHQEISAEAPQSMHFTLKNSTNLFRKAFGATADIDSFTDTPTVVTPSTPLELGDDLLRRRCFKCHLYDSG… |
| A0A2G2P2W0 | 28-479 | KDIQNSPADKHIRDLCANCHLGAEKKEYGEITQLSRGGGCNACHLNYSEEAKTDLVTYLSSEKKELPKFHPSTDIFVKNVHCFGCHS… |
| A0A3A4NMT2 | 129-662 | None |
| A0A256WDV7 | 1-391 | None |
| A0A7V7N0X5 | 2-461 | None |
| A0A357ZK95 | 2-416 | None |
| A0A2E7Y493 | 171-623 | None |
| A0A7I8MJP5 | 1-666 | None |
| A0A2Z6AZ63 | 36-478 | None |
| A0A2E6VQ87 | 116-649 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.