DPCstruct | MC15302
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 137 ± 22 aa |
| Standard deviation of domain lengths | 22.32 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3BEQ8 | 1-119 | MGVDCGFDMVPFFAKGDSNDGWERFLDDVLKEFKDDPVVVPGELEIIFQVGEFPVLPRAGYAFRRFSSKVSGSCGASERYIIRVYRI… |
| A0A3D8R491 | 1-148 | MGVDCGFDIYPPLERTRANQEQYELFLREVLDTYRPRDGDGTKQGGGDSVVRVNAESAESYIEFEVGEHPHLPRRCEHFLRFSSKIS… |
| A0A4Q4U2K7 | 1-157 | None |
| A0A179FAA1 | 1-145 | None |
| Q0U172 | 1-121 | None |
| J5J2U7 | 1-156 | None |
| A0A3D8QS24 | 1-138 | None |
| J3P264 | 1-177 | None |
| J3PAU4 | 1-134 | None |
| A0A6A4GDP2 | 1-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.