DPCstruct | MC15301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 70 ± 2 aa |
| Standard deviation of domain lengths | 1.74 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 86.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 61.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0304 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5SI02 | 1-73 | MKTGTVTDISLDHDLGDDDRGTGYDVVLWIEEQVALHGFVPPAMKIHSANVSARTKMENGIRAIEAMVSRRVE |
| G3A2B7 | 54-121 | ETGSVEEISLDHDLGDDAHGTGYDVILWIEEAVALRGFNPPKITIHSANASAAEKMRAGVRAIERLAG |
| A0A2S7X601 | 29-98 | None |
| A0A5C5XTT7 | 29-98 | None |
| A0A1H7G198 | 103-171 | None |
| A0A076PS96 | 31-97 | None |
| A0A239JDA3 | 29-96 | None |
| A0A0S4P9M3 | 1-69 | None |
| I1YIH1 | 29-100 | None |
| A0A6N4T9P2 | 96-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.