DPCstruct | MC1530
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 60 ± 4 aa |
| Standard deviation of domain lengths | 4.07 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 34.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E0UGM5 | 1-57 | MLPTVEQALKSLYLCQSLTTAYQPIYMVRLDERNGKVFILAGEDIQILVSRDGNWEF |
| A0A0B0QVT7 | 1-63 | MEETTIYNPTAVQALTCLRVCEMLSNRLLDIHLVRFDEIERYVYILAGDEMEILIFPEGNWRF |
| A0A2H2XWX9 | 6-63 | None |
| A0A844MNY5 | 18-68 | None |
| A0A0S3UCD2 | 11-73 | None |
| A0A6P0TDK7 | 1-63 | None |
| A0A139X3E8 | 8-67 | None |
| A0A1Z4FYR2 | 26-86 | None |
| K9RMY5 | 45-104 | None |
| A0A2P8W598 | 1-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.