DPCstruct | MC153
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 135 ± 10 aa |
| Standard deviation of domain lengths | 10.31 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 31.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07332 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9E3E6 | 2-106 | RQELELAKLEMKEEATKAGKAAGMLAGAGVAGHMALVFISLTVMWALGNVMNLAWAALIVTVLWAIAAAVLGSAGRKKLKQVNPKPE… |
| A0A1S8C9C5 | 2-139 | AHSLPTHPQTGSTAAGSTEPSVGTLAKSAMADVSTLVRSEIELAKAEIGASVKRGGAGAGAFAAAGAMLAFAGFFFFFFLAELLAVW… |
| A0A838KL07 | 1-137 | None |
| Q6AHI2 | 47-181 | None |
| W5WA97 | 289-419 | None |
| A0A506Y631 | 9-136 | None |
| A0A6G3BQ23 | 10-136 | None |
| A0A6P2CEH8 | 20-172 | None |
| A0A6N8GGR6 | 4-142 | None |
| A0A179B428 | 71-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.