DPCstruct | MC15297
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 122 ± 12 aa |
| Standard deviation of domain lengths | 12.21 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W9YGG1 | 23-172 | PATRGDGFLPDLKAGASSGRIGEETLGLVRAAPIDVPALDRRRLAEYAAAHRNRRADSDAEDRGSYVASPARVEDVPTAVRSRWEVD… |
| A0A3A9VVH7 | 18-138 | RERGLDAIRSASLELPALSPAELRALAVRHRNLRDAKRAALSWGHRPSAVSAESAVPAELARWQVEYLRDVLAPHSLLVEALPPGRS… |
| A0A5C4XGE3 | 101-214 | None |
| A0A847GTL6 | 189-306 | None |
| A0A2S0M132 | 1-133 | None |
| A0A4U1KPG6 | 85-200 | None |
| A0A4D7JMW2 | 8-118 | None |
| V9XR99 | 1-126 | None |
| N1WHX2 | 51-154 | None |
| A0A1Y2NQN2 | 85-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.