DPCstruct | MC15296
Metacluster Properties and Pfam Annotations
| Number of structural domains | 206 |
|---|---|
| Mean domain length (aa) | 275 ± 73 aa |
| Standard deviation of domain lengths | 73.21 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 81.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.31 |
| Pfam Score | 74.12 |
| Assigned Pfam label(s) | CL0023- PF06470 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A510L698 | 177-453 | ELKIKKLNEKIDELRKEYAEINKQKNEISYKLESFEVKHKAIASAIEKNETFNRSIKHILNEKIDGVIGAFVNLIDVPSGFEEAIQT… |
| A0A833QXG0 | 31-240 | KNEIDRLDSEIVKAQKNLDMAQPGDTRRGLHSVNRIIDNYNIEGVYGPILELIDCEEKFFTAVEVTAGNSLFHVVVESDDISTQIIR… |
| A0A165ZLI9 | 112-370 | None |
| A0A654HGV3 | 436-605 | None |
| A0A654HD28 | 440-679 | None |
| A0A4Y7LGZ6 | 105-477 | None |
| A0A7R9L116 | 135-320 | None |
| A0A4Y7J9Q8 | 567-942 | None |
| A0A7S4PPT1 | 144-470 | None |
| H3BA46 | 311-627 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.