DPCstruct | MC15294
Metacluster Properties and Pfam Annotations
| Number of structural domains | 110 |
|---|---|
| Mean domain length (aa) | 190 ± 24 aa |
| Standard deviation of domain lengths | 23.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.17 |
| Pfam Score | 98.08 |
| Assigned Pfam label(s) | PF14025- CL0032 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1MHT5 | 2-229 | LGEITTPSGSLAIFDIGLLGILPRDALEPAIVTCPVPTDRPLTVIGRAVGKGRLADRWDHVAVVLGAGTVARSRKLGEAGVNFARLV… |
| A0A1C5V842 | 21-234 | DDLEAHFTEKVIGNMAVDVLDIGAVHFPTGQIFACDPLVELEDTLPFMQTIPAGTYPVKICVVPSEQYGDRYACVKVEVSQEKPVRY… |
| A0A7X9CS53 | 3-240 | None |
| A0A1Q9TZ29 | 2-155 | None |
| A0A7G5LTG5 | 8-170 | None |
| A0A3N5QKG2 | 241-420 | None |
| A0A373C0C8 | 27-245 | None |
| A0A4S8IXA7 | 384-578 | None |
| A0A1C2HSP3 | 60-248 | None |
| A0A7J5BNT3 | 75-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.