DPCstruct | MC15292
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 204 ± 33 aa |
| Standard deviation of domain lengths | 32.76 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19541 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150T4E1 | 2-154 | VRNAVPFRATFDGHTLAVAPEATRLAEGAAAVERTFARAFGEDFIAANRGALWYLTKYFTPHPPGEPHFFVKPWAFTRTPPGWSSLL… |
| A0A562SU19 | 9-211 | HQYCEGVTTASRQGWYVFPPTRFDLMWTGNEVVFKIGDSQDWTVLDRFYLQDSVESFLAHAPESVHDCYPSFLDVFPEGNIVQICSG… |
| A0A2D4SNP0 | 3-222 | None |
| A0A381YSN4 | 2-171 | None |
| A0A2D8XD26 | 35-232 | None |
| A0A496T4L5 | 9-191 | None |
| A0A2E8AVP4 | 321-532 | None |
| A0A1Y2ST54 | 2-216 | None |
| A0A5P9H2T5 | 26-201 | None |
| A0A0C1ZNW0 | 1-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.