DPCstruct | MC1529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 162 ± 23 aa |
| Standard deviation of domain lengths | 23.12 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B7IJD0 | 1-180 | MKLRINNLGAVKEAEIDISKKLNIFCGPNGTGKTYVAYALYGALKPKFHIGSNDELIDELIKNKNITINIDFESINNYREGLISSFR… |
| A0A0B0QLV5 | 1-196 | MKIKFSNLGGIQETELDLRSLTVIIGPNNSNKTYIAYSIYGLWQRAGRTLRIQGNEKLEIKHQEDDTWSLKIDNDLLDFFIRDIETT… |
| A0A2K9EAV3 | 3-139 | None |
| A0A824XGS2 | 1-170 | None |
| A0A496V4F7 | 1-175 | None |
| A0A838YIR0 | 135-309 | None |
| A0A1H6FEV4 | 1-139 | None |
| A0A510JS05 | 1-120 | None |
| L8NRY4 | 27-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.