DPCstruct | MC15288
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 324 ± 19 aa |
| Standard deviation of domain lengths | 19.08 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 75.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815NTI7 | 25-356 | IELFAWIRLQDQLFDQYFSHYSFTVNTDDLWDMFLKLGKFNIINSVNQKHVISILTEKIPLTSIETFRRYTKLAKTYLIEIKPEFRS… |
| A0A814HPA7 | 112-446 | AELFTWLRSQDQLFSQYFYHYSSNVNTDELWDMFLYLCRLNTINNITQKYLVTILSERIPSVSVELFHRYTKLAKTCLTEIKSESRS… |
| A0A815V6M8 | 2-336 | None |
| A0A819YZR5 | 5-330 | None |
| A0A820S4U1 | 1-302 | None |
| A0A816YM16 | 220-555 | None |
| A0A818W2T3 | 288-620 | None |
| A0A819Y6N4 | 1-273 | None |
| A0A816GJT0 | 52-390 | None |
| A0A821YCM2 | 185-489 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.