DPCstruct | MC15287
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 225 ± 46 aa |
| Standard deviation of domain lengths | 46.29 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 67.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2HFM1 | 1-173 | MRDEMRQGGFDESGTFIRKQDANARYDNWLAGVTDADMESAAMAQEAREQERQAHERAVESRLARFGSQPHQLVMALCGVLLPRETP… |
| A0A814FHN3 | 18-258 | HKKQKYTTHDTRLHSGKYTLDSDEDDDDAEQGNVKEMNQNDLDEIGQESATIGFDDDVKITPFNIDEELEEGHYDETGCYQWKKKDK… |
| A0A6V7UPY7 | 8-188 | None |
| A0A177WWF8 | 93-337 | None |
| A0A6T6CNK6 | 1-327 | None |
| A0A367LRY1 | 180-409 | None |
| A0A507EXK2 | 102-285 | None |
| A0A5E4FZT3 | 12-214 | None |
| A0A1I7S053 | 45-249 | None |
| A0A7S2LE76 | 5-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.