DPCstruct | MC15286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 105 ± 11 aa |
| Standard deviation of domain lengths | 11.24 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 30.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1I8R0 | 2-98 | SKSNGAVFNESYRDLKLIDEVKKKYKSLIPCKFENYELITTPFRLLKLSEVIKDNAFLKILQKDLLNLDYVRKDNDLYNLQQSADLN… |
| A0A814EVG3 | 1-115 | MSSTEKKPRLVSVNSILTDNDSIKRFRDAYTSQLPIHEKVIRLEHEPFSYCTIDDFVLDKNVDQFCNQLINELNNIKMNQKNNDLYK… |
| A0A6A4X689 | 1-92 | None |
| A0A5C6NN66 | 2-116 | None |
| A0A2K6KZI6 | 2-101 | None |
| A0A2P8Z5F2 | 2-114 | None |
| A0A4Y2QD74 | 1-121 | None |
| A0A3B1K777 | 1-86 | None |
| A0A2K5RDU5 | 1-93 | None |
| A0A1Y1MRR5 | 38-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.