DPCstruct | MC15285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 119 ± 9 aa |
| Standard deviation of domain lengths | 8.92 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 40.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1P8C1 | 181-297 | KWTVQFCTRVPPSAAPIVPIGNAGVHIVRLKILFFLQITRIPYNGKEWKDSPSLVLPMVYDLNSNLTQLAEKREQPQSPGAIAASTL… |
| A0A814EJR7 | 2-130 | PESHHLWRARWCLAIPQGSGFTQVGQPAIYYMPSRSSFLFMFQFISRISQNDSQINISNTSTFIVPLIHDMISNQTTLWDGLNKQPT… |
| A0A212BZQ5 | 8-112 | None |
| V5GYB5 | 3-117 | None |
| A0A6J2JFV8 | 485-603 | None |
| A0A8B6F3V7 | 425-552 | None |
| A0A0N1PJW1 | 363-475 | None |
| A0A6P8HJ17 | 1-105 | None |
| A0A7F8QT16 | 481-598 | None |
| A0A023FH14 | 23-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.