DPCstruct | MC15281
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 140 ± 20 aa |
| Standard deviation of domain lengths | 20.46 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E5SFN4 | 134-271 | WGDDASVEEILHTINHVGHVSLYPDEFNISPNSSIMSDAMDIARGGQFLNVPNNYPEEAWYHYDDWTCDYECMAIEYLYWCIVSHMG… |
| A0A2E9LE49 | 17-122 | SRIADAMDTARGGQFQTVPNGYPEGAWYSYDDYTCDYSCQIHEYFYWILMANIDALDPAYTNKCADSEEEWHVCTKDELKQIDPLAY… |
| A0A7W2H406 | 195-350 | None |
| A0A2E4ZYA5 | 152-284 | None |
| A0A2E1H6Y3 | 359-494 | None |
| A0A838YJN0 | 17-138 | None |
| A0A432FFS9 | 134-270 | None |
| A0A7X3UJJ0 | 43-196 | None |
| A0A2E0GL97 | 609-779 | None |
| A0A2E4FX74 | 66-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.