DPCstruct | MC15273
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 139 ± 14 aa |
| Standard deviation of domain lengths | 13.89 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7WT47 | 2-135 | AGNLKTTFARAEDVRGMFRLVLFWGAFPQQLGRVAFLDCADDGIDFVPYAPDDEYRIVDDLPPQEALEQAGDFVSVHPDFQHISLAK… |
| A0A351Z3C9 | 23-155 | GSQALALTGYGSFAPSTNVKQAFDRFQIDSNLNYYLCGSETVPDAIIGIDKGFTLNSDLWQPIEVTPKVFRRLVLDMQKEHGNLLGA… |
| A0A432R4H7 | 1-119 | None |
| A0A661ILN6 | 1-142 | None |
| A0A3C1FU35 | 21-161 | None |
| A0A522UPE7 | 1-145 | None |
| A0A2N6FEU0 | 14-135 | None |
| A0A7W0ELY9 | 19-159 | None |
| A0A7C4MSQ7 | 24-185 | None |
| A0A0F9CW26 | 88-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.