DPCstruct | MC1527
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 131 ± 21 aa |
| Standard deviation of domain lengths | 21.18 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.98 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0123- CL0738 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A828UJS8 | 4-85 | GLPARNHLARMCHSLCIAVNYNNGAVVIKTPPGAAQYLGSAIDTSGVHTVLGTIAGDDTVLVVCKVGVDGEDLARLFREMAE |
| A0A6B1BVK3 | 13-159 | ELITEGPITRQEELNAALKDIGISTTQSTLSKDIKELGIAKVPDGEGGFRYQIPETSIGSERMSLQGDDLLRRELRDFVIGVESVAH… |
| A0A1H8TJY0 | 11-154 | None |
| A0A7C2PVJ4 | 21-150 | None |
| A0A1H1W3M0 | 75-228 | None |
| A0A655DIB4 | 1-104 | None |
| A0A265Q2Z8 | 8-169 | None |
| A0A7J5ULL7 | 13-109 | None |
| A0A645J104 | 1-85 | None |
| A0A2S8BPA5 | 228-353 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.