DPCstruct | MC15267
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 106 ± 13 aa |
| Standard deviation of domain lengths | 12.95 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04327 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4QSQ3 | 1-92 | MVEVLIERDDEGRVQVVTLYGDDSPEGLAARMLVEAPILGMKNYLHLDPEVSREGSVLRVRVDRSDLFLDREIDAIMETMVLGLQAL… |
| A0A7C1DLF0 | 10-117 | MTEIRILRCGNNICGIEISGHSGYAGHGQDIVCAALSTLTQTLEIGLIDVLDIEGVVTRKDPVSGYAKIFWGKRNSGRISDLVKTIV… |
| A0A1G3QTP5 | 10-99 | None |
| A0A843GHE6 | 1-122 | None |
| A0A0S7ZI28 | 3-94 | None |
| B1UYX5 | 13-100 | None |
| A0A7X2MY96 | 1-122 | None |
| F0YWR3 | 5-90 | None |
| A0A1F7I4X2 | 7-108 | None |
| A0A496QVC5 | 27-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.