DPCstruct | MC15261
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 271 ± 46 aa |
| Standard deviation of domain lengths | 45.88 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 66.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 21.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15496 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9VTR5 | 888-1130 | QTSTLMSETATGRPDQPPCFDRPPAQHDSYYRYEPFEAFSFSANLLNHPHQLHLPPELVSRDVNEQDWMKFIEDLAREALHGASHSL… |
| A0A5C2RX52 | 1-260 | MIDVEKNPADFKDINDVRQGPQAGPSYSEPPPPSYPGPSNSSLRLDFQKLPPPPMTHMPSFAPSPDGTPGPELPGDNPKGFMGHVKN… |
| A0A5C3L4D4 | 193-530 | None |
| S7Q470 | 1-263 | None |
| S7RA45 | 39-331 | None |
| A0A4S9MTK1 | 10-339 | None |
| A0A194XR60 | 27-278 | None |
| A0A0H2RJV9 | 1-256 | None |
| V2X3K9 | 1-213 | None |
| A0A0C3ANV8 | 115-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.