DPCstruct | MC15260
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 153 ± 22 aa |
| Standard deviation of domain lengths | 21.91 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 64.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H2RNM4 | 46-195 | PPTDGNGHPTDPNAHAGAYMMAFPPPPPGMIYAYPTAQGYPTLPFAPGMTLPAALARPKRKQVKTACTNCAAACKRCDDARPCERCC… |
| A0A5C2RTK7 | 1-141 | MSMDREYFFIPTVHLRRSPFRPHEVGIPIQYLQSAASSSYLGTPVTQPLATKGPRPPAVRIACVSCRHASRKCSERRPCERCIQRGI… |
| A0A4Y7QJB0 | 58-212 | None |
| A0A1C7N6L6 | 1-113 | None |
| D3BAA8 | 64-187 | None |
| A0A1X2INA6 | 1-147 | None |
| A0A166BQT9 | 225-404 | None |
| A0A077X0N0 | 17-163 | None |
| A0A077WFN7 | 37-200 | None |
| C9ST60 | 15-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.