DPCstruct | MC1526
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 166 ± 15 aa |
| Standard deviation of domain lengths | 14.61 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A8KHV5 | 3-163 | RVGMELLGGAAGGVVGATVLGSFGYLLGSATVGCDECLVVAVAGTAAGALIGIPVGTYGGGRFMNGRGRLGATVAGSMVGWGATLLG… |
| A0A6B1BSL2 | 25-193 | LQDSEIDKLKETTDTLSVKKENKTKRIVGKLAGGVLGGGLFGLMGGVAGGAISDCSTEDPYCKLEYGAPGLLLGYFIGVPVGMNLMD… |
| A0A2V7ILI9 | 10-182 | None |
| A0A085WQP2 | 6-193 | None |
| A0A085WLZ8 | 48-233 | None |
| A0A085WUX4 | 1-171 | None |
| A0A848LMT5 | 2-145 | None |
| A0A6B0X409 | 94-254 | None |
| A0A6L7T2T7 | 90-269 | None |
| A0A6B1BG15 | 122-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.