DPCstruct | MC15259
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 117 ± 13 aa |
| Standard deviation of domain lengths | 12.96 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9XC21 | 71-178 | VLDLVHPSLFPVVYGRTRALGKGKGFATLDDCIAKCGEGDVLKKQKVRGGNFSADFQWLPCEVDISEDDKQARITSYINNLHTAKHK… |
| A0A4E9DJT6 | 215-324 | LFPLVYGRSRVFREEVVGVEDAIDRWSGKGEVIPKYQKPSSDKQRYYGTGIGGDQVDDSYWSENYQWLPSNVAFQEDGSVKFTSYIN… |
| A0A177ACG3 | 1-110 | None |
| W7N7C6 | 260-362 | None |
| A0A3L6N4W4 | 227-340 | None |
| A0A842YSJ6 | 1-150 | None |
| M7TZ03 | 110-240 | None |
| A0A2D4BJS2 | 364-479 | None |
| A0A4T0B3F8 | 183-286 | None |
| A0A559L1V2 | 176-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.