DPCstruct | MC15258
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 109 ± 7 aa |
| Standard deviation of domain lengths | 6.51 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 75.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0DEI9 | 2-103 | KRVDVLKEGLSKLHNQIWDRKTKLEIELKAGQIISEADQDWLDGDGNLVDDERVVEALDNASDYEQGLEGLNSQDKLIVEKLQKLAG… |
| A0A5C2RNT9 | 1-116 | MPSDRLTELRKALSLLEKQVASRKACLEASLAKKETLTSEDEAWLDHDANLVDERYALDVLSCAPNHDAALAELTLEQKEAVARLEK… |
| V2WNX5 | 1-109 | None |
| A0A0C9WM14 | 1-99 | None |
| A0A1Y2IBS5 | 1-114 | None |
| A0A0C3EQH4 | 4-118 | None |
| A0A5C3M1F0 | 1-106 | None |
| A0A6A4GGH8 | 1-107 | None |
| A0A060S442 | 1-110 | None |
| A0A0D0DYE9 | 3-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.