DPCstruct | MC15257
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 445 ± 97 aa |
| Standard deviation of domain lengths | 96.86 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 88.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13196 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K8Q1E7 | 2-285 | AELSIDNGKMTLASQTSASALGTFAPPVALDSEQQQIYSARLGKYMQDVNLTPDFPSSAATALEMWEKKNGERLDGVISVDPVALGY… |
| A0A837IGM5 | 34-490 | IVTTKTMTSVASEKNIILAKKLLSKIDFERLITLVSNGRIIAGTLPEMLGQDTSKTYLLLFENNMELRPTGGFIGSFGLVTFEKGRL… |
| A0A2D6L5I4 | 345-866 | None |
| A0A5N9C847 | 689-1195 | None |
| A0A8B0KRQ5 | 3-329 | None |
| A0A7W1A8F3 | 151-653 | None |
| A0A7Y3B4V9 | 113-571 | None |
| A0A8B5XEC7 | 153-611 | None |
| A0A7V9IK38 | 250-734 | None |
| A0A3M0Z3F8 | 225-738 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.