DPCstruct | MC15252
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 173 ± 17 aa |
| Standard deviation of domain lengths | 16.51 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8ATB3 | 2-175 | DYTLDENLEFEGDLIITANIDLNGHTLVVKGDLWHLGGRISVNNGNLIVYGSYYIESFAGGQVDAKLAMINEEDYVQVFGDFVMHSI… |
| A0A7X8JVQ9 | 124-287 | ISSDIVLEEDRTYRNLVLEEGATIDLNGYALYVKGDFLQNEGNVIINSGSLNIDNNHTIYEEGMLQMTNEADYVYVGGNFTTNSAAD… |
| A0A1E3BY89 | 5-144 | None |
| W4VD79 | 4-169 | None |
| A0A0L6JXF5 | 179-385 | None |
| A0A0Q6HTZ3 | 24-210 | None |
| A0A8A3PYG8 | 126-311 | None |
| G8M230 | 464-637 | None |
| G8LXL3 | 750-911 | None |
| A0A2S8RBI3 | 31-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.