DPCstruct | MC15251
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 144 ± 11 aa |
| Standard deviation of domain lengths | 11.49 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S7NQQ6 | 22-147 | SSSKIPEFKGTVGQLDLDGGFSDFLEHHQEAVVRLDVVIPRSEFQGGSEKEFDFIDVFDTCDEVLKEGETPSAPRCQGTEYNLPKVQ… |
| A0A6N6MA97 | 1-149 | MELIIAITAIIIGLIALIYQLKEYNKKRVPEFKGQIEVDTNDGDCISFYDFLFKNDGKIVFIDIYINNLTEGQVFDDESNFTFSCYY… |
| Q2LV69 | 32-166 | None |
| A0A454B3Q8 | 115-261 | None |
| A0A4S5D6E5 | 103-234 | None |
| A0A0T6UL45 | 11-168 | None |
| A0A2I2KS74 | 77-209 | None |
| A0A5E9PF14 | 21-175 | None |
| D6Z689 | 39-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.