DPCstruct | MC15249
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 91 ± 6 aa |
| Standard deviation of domain lengths | 5.58 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 75.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 45.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H8NG18 | 1-91 | MSNTPTASDGNAIDRAETVGTARTRIADLRTADGEFVVACRDSGVRPEPVTDARFASYADAERACSAARQYRTAMRELDPGLTQHDL… |
| A0A1G8X4V2 | 1-95 | MIETPLTDIRSYIESLSSDSGEYYLVCARTGEQPVPAAGCRFDSREQARAGARATEQYRAQLRQYDPRVACHDIIVCQAHAPPERAT… |
| A0A6G3ZKP5 | 2-91 | None |
| A0A6G3ZJU8 | 1-85 | None |
| U1PAG1 | 1-95 | None |
| M0MKC5 | 1-89 | None |
| M0DBG3 | 1-94 | None |
| A0A2R6D0B4 | 1-94 | None |
| M0LVP4 | 1-101 | None |
| M0EDK1 | 1-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.