DPCstruct | MC15248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 144 ± 18 aa |
| Standard deviation of domain lengths | 18.06 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14713 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653C6A5 | 2-138 | VKDDPLKIELALRERSNRVGILSTIIFIKLETKAGYEISGYLDYGDKLVLENWKPIFVGHKKIMPKLTDLGYYNWRSGKVVCNDSSH… |
| A0A3P8TXD7 | 37-184 | LSVVFSRTLASAGKELKDNFLKALAEREEANRSGKMTSVIFIRDHNTLGQEVSGYIDYTHRLKTQDFEPYFISFYCSMSTLTQVSTS… |
| A0A812UWA7 | 770-916 | None |
| A0A556U836 | 312-459 | None |
| A0A6P5VNE1 | 171-328 | None |
| A0A812RSR6 | 77-217 | None |
| A0A2R6XQ23 | 100-267 | None |
| A0A6P4KL18 | 9-151 | None |
| A0A4Y2PR42 | 16-111 | None |
| A0A672GKP0 | 78-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.