DPCstruct | MC15246
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 228 ± 55 aa |
| Standard deviation of domain lengths | 54.54 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 76.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N5N8T1 | 167-399 | APALDPERLAELKESLSSGQGALWAGHALLLALLCGLVSKRLTGRYRGLLVNERNVMSLSRFQTVVWTVLLLSAYYTAASLRAYGLA… |
| A0A6P0AW13 | 292-510 | PAPIQIAVVSVDGKFVGHGGLRAYPRLWGAMIASVLTAALFGAILRTRYVTTVPDAKDETDWGRWFSGLFISDGDKDPSLSLFQVFF… |
| A0A1K1M6D6 | 36-229 | None |
| A0A6G6Z047 | 97-315 | None |
| A0A4R2J813 | 4-177 | None |
| A0A7C7Q1C5 | 3-248 | None |
| A0A1M6IRV9 | 61-264 | None |
| A0A844SE59 | 203-487 | None |
| A0A2G8SZI4 | 10-209 | None |
| A0A7D5R296 | 42-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.