DPCstruct | MC15244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 79 ± 8 aa |
| Standard deviation of domain lengths | 8.32 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A351WUB9 | 50-125 | ADNLLFSVPVAHAEELDHQLIPDLLRHRLERRGDRLGTLAQVEVRDPGRLWCICDEGRSYSIRKLTARLAVYLGAS |
| A0A524Q8C0 | 35-104 | KEYLFSIDTKFEVELNTGSISEELKKEFGKNRFSLLDNAAVTKEEEKIWVITDKKKYIIRKEKETLNIYT |
| A0A842XL42 | 683-755 | None |
| A0A2D0HDN4 | 251-322 | None |
| A0A7C6ZUS7 | 79-170 | None |
| A0A1D2RB64 | 264-331 | None |
| A0A1D2RA36 | 51-130 | None |
| A0A1D2R9L3 | 341-416 | None |
| A0A3A0BJN2 | 122-220 | None |
| A0A2E0XCM1 | 223-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.