DPCstruct | MC15241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 100 ± 14 aa |
| Standard deviation of domain lengths | 13.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A351VJ36 | 1-103 | MYQYPNIPTDVNNQKLAGAAVFNPKSGLWEPAPYDPLVHYKRANGDSSGDPAYHGFTAADGSWFIMKMNLVDENERFARGMADFPTA… |
| A0A2M7W791 | 36-125 | TIALKDSTGATIDPAKNHPTDGYKISQLDDSGSTYLYFAYVNKDGAWYIQRETISGINTGDYRYFKGSSDFAANWSNRSGLAYDDFD… |
| A0A6H1ZYR3 | 3-85 | None |
| A0A7V5L527 | 1-119 | None |
| A0A0F9GYE6 | 35-156 | None |
| A0A0G0UFI7 | 150-239 | None |
| A0A0G0PPN7 | 185-275 | None |
| A0A0G1ECX3 | 133-214 | None |
| A0A0T5ZY92 | 207-309 | None |
| A0A0F8ZUR2 | 89-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.