DPCstruct | MC15240
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 83 ± 7 aa |
| Standard deviation of domain lengths | 7.28 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 50.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09440 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7MUJ6 | 13-107 | LFQNLEAKYGFKQEMLDDMFEAARVFYDSGLYNIASDYLRIIRQLVSPSDSRHLHACWGRLASEILVQSWDEALDDLEKLKDAIDCQ… |
| A0A811QHZ1 | 3-80 | IGSDQIEALYDNAKFEFECGCYSDAVAYLNQYRVLSTNGERTARALWGMLASEILNRNWDAALEELNRLKEIIDSKVY |
| A0A0D9WVX5 | 151-233 | None |
| A0A835P3Z3 | 78-177 | None |
| H2YYS3 | 62-143 | None |
| A7T8Y0 | 93-175 | None |
| A0A427XQH9 | 601-674 | None |
| A0A0C4F858 | 23-105 | None |
| A0A5D2ZZP6 | 6-82 | None |
| A0A063BUX3 | 121-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.