DPCstruct | MC15239
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 116 ± 18 aa |
| Standard deviation of domain lengths | 18.31 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 55.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811QF84 | 1-104 | MPLPNPMVGFSLPDQWPRPVNRDLPSQAMGPPYFYYENVALAPKGVWTIISRFLYDIQLEFVDSKYFCAAARKRGYIHNLPLENRSP… |
| A0A453ND66 | 1-119 | MPLPNPMVGFNLPSDRLRSVKRRLSEKAIGPPFFYYENVALAPRGVWRTISRTLYDIEPEFVDSKYLCAAARKRGYIHNLPIDNRSP… |
| A0A287Q3M1 | 1-118 | None |
| A0A446N3E3 | 99-217 | None |
| A0A0E0H915 | 675-775 | None |
| A0A1U8FHL2 | 435-552 | None |
| M4CJK4 | 196-357 | None |
| A0A6A2Y7C6 | 2-113 | None |
| A0A6A2YIV6 | 165-263 | None |
| A0A6A2YSK6 | 143-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.