DPCstruct | MC15238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 158 ± 16 aa |
| Standard deviation of domain lengths | 15.64 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0613 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1NPW3 | 27-181 | VLHETLNDISSEVLAAHGVDIHPHLQNAWMMWLLNWRKGEDVLGEAELIVQTVYMSSGRCLSKESLSHPQYQSISSLTNDICHILFH… |
| A0A811Q9Y6 | 8-163 | RGRPSAQPWKQWLMARSAKEAQETCEGSTALLLVRTVKICSGRHNLMEEQNVNSLEYSQLERLNFSIGSKLASTVRAQGNDQNGKNM… |
| A0A1U8E4H0 | 4-119 | None |
| A0A3L6RMR7 | 277-439 | None |
| A0A3S3MS18 | 10-177 | None |
| A0A0D9XS82 | 127-284 | None |
| A0A287Y139 | 39-212 | None |
| A0A5B7C0B5 | 1-139 | None |
| A0A6A1UVR8 | 226-394 | None |
| M0ZP67 | 8-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.