DPCstruct | MC15237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 58 ± 3 aa |
| Standard deviation of domain lengths | 2.81 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.98 |
| Mean intra-cluster local Distance Difference Test score | 0.97 |
| Mean intra-cluster sequence similarity (%) | 82.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0QC98 | 113-169 | AVYAVEFSHRSGRDLINMAKSRTNVIPIIEDARHPLKYRMLVPMVDTIFADVAQPDQ |
| A0A813LTU7 | 304-360 | MVYAVEFSHRPGRDLTNMSKRRPNIIPIVEDARQPQRYRMLIQMVDVIFADVAQPDQ |
| A0A812LQ15 | 970-1026 | None |
| A0A7R8CXF5 | 188-244 | None |
| A0A821XMT3 | 299-361 | None |
| A0A146HEG6 | 174-230 | None |
| A0A0N4W9K8 | 72-132 | None |
| A0A7E6EWC2 | 396-452 | None |
| A2Y0X0 | 168-228 | None |
| A0A1D6LQV3 | 66-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.