DPCstruct | MC15236
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 223 ± 42 aa |
| Standard deviation of domain lengths | 42.45 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.17 |
| Pfam Score | 94.97 |
| Assigned Pfam label(s) | CL0023- PF20428 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834XED8 | 2-161 | VYPAYTTMLGHLRAKALESYKAKLEHSLKNGEGFAASVRMLIQSSMLEFDQGSADAAIRQANWDASKVRDKLCRDLDSHASSVQSAK… |
| A0A811Q865 | 311-510 | NEKLKNFLSDKGWYDMETMYFDEGVRAAKRQQLQSSMLDHTYPAIERVMEHLHLVALNKFKSDLEQSLRTQRGFAESVRQCSQASVE… |
| A0A287QEG0 | 40-338 | None |
| A0A1R3JPP0 | 3-156 | None |
| A0A6A6LJ66 | 308-549 | None |
| A0A1D6FXZ5 | 4-222 | None |
| A0A7J9EPZ6 | 23-264 | None |
| A0A540LXU4 | 2-182 | None |
| I1BJD1 | 140-429 | None |
| A0A540MIU6 | 149-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.