DPCstruct | MC15235
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 206 ± 16 aa |
| Standard deviation of domain lengths | 16.04 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 67.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04859 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822Y3F4 | 28-210 | MDSATKPVKPSSNISDIVYRFAKVCRLKSIGVFPGETPNHHHGNNGPATEDSSDATEEAEYDFQKIHPQPIEETLGRPPQDSVLTVI… |
| A0A811Q7C7 | 1-236 | MAAAAAALGGEERGASRIFLFWEQMRERDIGEVGGKAVGATAYRSTAAPDAGDEHGSSRQGKARSQRRGMATKPVAVNDLIHCVASS… |
| A0A1R3HWR3 | 1-189 | None |
| A0A427A9E1 | 98-316 | None |
| A0A4S8IZX1 | 1-223 | None |
| A0A6G1EI79 | 2-198 | None |
| A0A4S8I7H4 | 2-206 | None |
| A0A426Y9N6 | 1-199 | None |
| A0A445M0G8 | 60-253 | None |
| W1PPF8 | 59-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.